SCOP 1.63: Domain d1mhha2: 1mhh A:108-213

Lineage for d1mhha2 (1mhh A:108-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-HCV Fab 19D9D6, (mouse), kappa L chain [81953] (3 PDB entries)

8. Domain d1mhha2: 1mhh A:108-213 [79120]
   Other proteins in same PDB: d1mhha1, d1mhhb1, d1mhhc1, d1mhhd1, d1mhhe_, d1mhhf_

Details for d1mhha2

PDB Entry: 1mhh, 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhha2:

Sequence; same for both SEQRES and ATOM records:

>d1mhha2 b.1.1.2 (A:108-213) Immunoglobulin (constant domains of L and H chains) {Anti-HCV Fab 19D9D6, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1mhha2:

• d1mhha2 is new in SCOP 1.63
  
• d1mhha2 appears in SCOP 1.65
  
• d1mhha2 appears in the current release, SCOPe 2.08