Lineage for d1mgqf_ (1mgq F:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296506Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 296507Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 296508Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 296509Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 296555Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 296561Domain d1mgqf_: 1mgq F: [79104]

Details for d1mgqf_

PDB Entry: 1mgq (more details), 1.7 Å

PDB Description: crystal structure of a heptameric sm-like protein from methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1mgqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgqf_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisp

SCOP Domain Coordinates for d1mgqf_:

Click to download the PDB-style file with coordinates for d1mgqf_.
(The format of our PDB-style files is described here.)

Timeline for d1mgqf_: