Lineage for d1mgqf_ (1mgq F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786773Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2786819Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 2786825Domain d1mgqf_: 1mgq F: [79104]

Details for d1mgqf_

PDB Entry: 1mgq (more details), 1.7 Å

PDB Description: crystal structure of a heptameric sm-like protein from methanobacterium thermoautotrophicum
PDB Compounds: (F:) sm-like protein

SCOPe Domain Sequences for d1mgqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgqf_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli
rgdnivyisp

SCOPe Domain Coordinates for d1mgqf_:

Click to download the PDB-style file with coordinates for d1mgqf_.
(The format of our PDB-style files is described here.)

Timeline for d1mgqf_: