![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.174: Double Clp-N motif [81922] (1 superfamily) multihelical; array |
![]() | Superfamily a.174.1: Double Clp-N motif [81923] (1 family) ![]() duplication: contains two structural repeats of 4-helical motif |
![]() | Family a.174.1.1: Double Clp-N motif [81924] (3 proteins) |
![]() | Protein N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone [81925] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [81926] (8 PDB entries) Uniprot Q83LR6 |
![]() | Domain d1mg9b_: 1mg9 B: [79093] Other proteins in same PDB: d1mg9a_ complex with ClpS complexed with spk |
PDB Entry: 1mg9 (more details), 2.3 Å
SCOPe Domain Sequences for d1mg9b_:
Sequence, based on SEQRES records: (download)
>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa ayllrkhevsrldvvnfishgtrkde
>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea fieqttpvlpasrdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqaayl lrkhevsrldvvnfishgtrkde
Timeline for d1mg9b_: