Lineage for d1mg9b_ (1mg9 B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779712Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 779713Superfamily a.174.1: Double Clp-N motif [81923] (1 family) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 779714Family a.174.1.1: Double Clp-N motif [81924] (2 proteins)
  6. 779725Protein N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone [81925] (1 species)
  7. 779726Species Escherichia coli [TaxId:562] [81926] (11 PDB entries)
    Uniprot Q83LR6
  8. 779737Domain d1mg9b_: 1mg9 B: [79093]
    Other proteins in same PDB: d1mg9a_
    complex with ClpS
    complexed with spk; mutant

Details for d1mg9b_

PDB Entry: 1mg9 (more details), 2.3 Å

PDB Description: the structural basis of clps-mediated switch in clpa substrate recognition
PDB Compounds: (B:) ATP dependent clp protease ATP-binding subunit clpA

SCOP Domain Sequences for d1mg9b_:

Sequence, based on SEQRES records: (download)

>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]}
mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
ayllrkhevsrldvvnfishgtrkde

Sequence, based on observed residues (ATOM records): (download)

>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]}
mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
fieqttpvlpasrdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqaayl
lrkhevsrldvvnfishgtrkde

SCOP Domain Coordinates for d1mg9b_:

Click to download the PDB-style file with coordinates for d1mg9b_.
(The format of our PDB-style files is described here.)

Timeline for d1mg9b_: