SCOP 1.69: Domain d1mg9b_: 1mg9 B:

Lineage for d1mg9b_ (1mg9 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.174: Double Clp-N motif [81922] (1 superfamily)
   multihelical; array

4. Superfamily a.174.1: Double Clp-N motif [81923] (1 family)
   duplication: contains two structural repeats of 4-helical motif

5. Family a.174.1.1: Double Clp-N motif [81924] (2 proteins)

6. Protein N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone [81925] (1 species)

7. Species Escherichia coli [TaxId:562] [81926] (8 PDB entries)

8. Domain d1mg9b_: 1mg9 B: [79093]
   Other proteins in same PDB: d1mg9a_
   complex with ClpS

Details for d1mg9b_

PDB Entry: 1mg9, 2.3 Å

PDB Description: the structural basis of clps-mediated switch in clpa substrate recognition

SCOP Domain Sequences for d1mg9b_:

Sequence, based on SEQRES records:

>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli}
mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
ayllrkhevsrldvvnfishgtrkde

Sequence, based on observed residues (ATOM records):

>d1mg9b_ a.174.1.1 (B:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli}
mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
fieqttpvlpasrdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqaayl
lrkhevsrldvvnfishgtrkde

Timeline for d1mg9b_:

• d1mg9b_ first appeared in SCOP 1.63
  
• d1mg9b_ appears in SCOP 1.67
  
• d1mg9b_ appears in SCOP 1.71
  
• d1mg9b_ appears in the current release, SCOPe 2.08