SCOP 1.69: Domain d1mg9a_: 1mg9 A:

Lineage for d1mg9a_ (1mg9 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (2 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)

6. Protein Adaptor protein ClpS (YljA) [82642] (1 species)

7. Species Escherichia coli [TaxId:562] [82643] (5 PDB entries)

8. Domain d1mg9a_: 1mg9 A: [79092]
   Other proteins in same PDB: d1mg9b_
   complex with ClpA N-domain

Details for d1mg9a_

PDB Entry: 1mg9, 2.3 Å

PDB Description: the structural basis of clps-mediated switch in clpa substrate recognition

SCOP Domain Sequences for d1mg9a_:

Sequence; same for both SEQRES and ATOM records:

>d1mg9a_ d.45.1.2 (A:) Adaptor protein ClpS (YljA) {Escherichia coli}
kppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgvftaevae
tkvamvnkyarenehpllctleka

Timeline for d1mg9a_:

• d1mg9a_ first appeared in SCOP 1.63
  
• d1mg9a_ appears in SCOP 1.67
  
• d1mg9a_ appears in SCOP 1.71
  
• d1mg9a_ appears in the current release, SCOPe 2.08