Lineage for d1mg9a_ (1mg9 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411264Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 411265Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 411280Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)
  6. 411281Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 411282Species Escherichia coli [TaxId:562] [82643] (5 PDB entries)
  8. 411287Domain d1mg9a_: 1mg9 A: [79092]
    Other proteins in same PDB: d1mg9b_
    complex with ClpA N-domain
    complexed with spk; mutant

Details for d1mg9a_

PDB Entry: 1mg9 (more details), 2.3 Å

PDB Description: the structural basis of clps-mediated switch in clpa substrate recognition

SCOP Domain Sequences for d1mg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg9a_ d.45.1.2 (A:) Adaptor protein ClpS (YljA) {Escherichia coli}
kppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgvftaevae
tkvamvnkyarenehpllctleka

SCOP Domain Coordinates for d1mg9a_:

Click to download the PDB-style file with coordinates for d1mg9a_.
(The format of our PDB-style files is described here.)

Timeline for d1mg9a_: