Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Amicyanin [49505] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries) Uniprot P22364 |
Domain d1mg3c_: 1mg3 C: [79077] Other proteins in same PDB: d1mg3a_, d1mg3b_, d1mg3d_, d1mg3e_, d1mg3f_, d1mg3h_, d1mg3i_, d1mg3j_, d1mg3l_, d1mg3m_, d1mg3n_, d1mg3p_ complexed with cu, hec, na, po4; mutant |
PDB Entry: 1mg3 (more details), 2.4 Å
SCOPe Domain Sequences for d1mg3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg3c_ b.6.1.1 (C:) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d1mg3c_: