Lineage for d1mg3b_ (1mg3 B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064542Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1064543Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1064544Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
  6. 1064545Protein Methylamine dehydrogenase [57563] (2 species)
  7. 1064546Species Paracoccus denitrificans [TaxId:266] [57564] (6 PDB entries)
  8. 1064555Domain d1mg3b_: 1mg3 B: [79076]
    Other proteins in same PDB: d1mg3a_, d1mg3c_, d1mg3d_, d1mg3e_, d1mg3g_, d1mg3h_, d1mg3i_, d1mg3k_, d1mg3l_, d1mg3m_, d1mg3o_, d1mg3p_
    complexed with cu, hem, na, po4; mutant

Details for d1mg3b_

PDB Entry: 1mg3 (more details), 2.4 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (B:) Methylamine dehydrogenase, light chain

SCOPe Domain Sequences for d1mg3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg3b_ g.21.1.1 (B:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d1mg3b_:

Click to download the PDB-style file with coordinates for d1mg3b_.
(The format of our PDB-style files is described here.)

Timeline for d1mg3b_: