Lineage for d1mg2a_ (1mg2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808749Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2808750Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    automatically mapped to Pfam PF06433

    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 2808751Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 2808752Species Paracoccus denitrificans [TaxId:266] [50972] (5 PDB entries)
  8. 2808755Domain d1mg2a_: 1mg2 A: [79059]
    Other proteins in same PDB: d1mg2b_, d1mg2c_, d1mg2d_, d1mg2f_, d1mg2g_, d1mg2h_, d1mg2j_, d1mg2k_, d1mg2l_, d1mg2n_, d1mg2o_, d1mg2p_
    complexed with cu, hec, na, po4; mutant

Details for d1mg2a_

PDB Entry: 1mg2 (more details), 2.25 Å

PDB Description: mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
PDB Compounds: (A:) Methylamine dehydrogenase, heavy chain

SCOPe Domain Sequences for d1mg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg2a_ b.69.2.1 (A:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahaaavtqqfvi
dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
eelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d1mg2a_:

Click to download the PDB-style file with coordinates for d1mg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1mg2a_: