SCOPe 2.05: Domain d1menc_: 1men C:

Lineage for d1menc_ (1men C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (18 PDB entries)

8. Domain d1menc_: 1men C: [79034]
   complexed with gar

Details for d1menc_

PDB Entry: 1men, 2.23 Å

PDB Description: complex structure of human GAR Tfase and substrate beta-GAR

PDB Compounds: (C:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1menc_:

Sequence; same for both SEQRES and ATOM records:

>d1menc_ c.65.1.1 (C:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
rilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk
lyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsn
aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa
alqlvasgtvqlgengkicwv

Timeline for d1menc_:

• d1menc_ first appeared in SCOP 1.63
  
• d1menc_ appears in SCOPe 2.04
  
• d1menc_ is called d1menc1 in SCOPe 2.06
  
• d1menc_ appears in the current release, SCOPe 2.08, called d1menc1