Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (1 family) |
Family c.65.1.1: Formyltransferase [53329] (4 proteins) |
Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82468] (12 PDB entries) |
Domain d1meja_: 1mej A: [79029] |
PDB Entry: 1mej (more details), 2 Å
SCOP Domain Sequences for d1meja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1meja_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} rilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk lyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsn aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa alqlvasgtvqlgengkicwv
Timeline for d1meja_: