SCOP 1.63: Domain d1mdud_: 1mdu D:

Lineage for d1mdud_ (1mdu D:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.109: Gelsolin-like [55752] (2 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (15 PDB entries)

8. Domain d1mdud_: 1mdu D: [79017]
   Other proteins in same PDB: d1mdub1, d1mdub2, d1mdue1, d1mdue2
   domain 1
   complexed with atp, ca, hic, trs

Details for d1mdud_

PDB Entry: 1mdu, 2.2 Å

PDB Description: Crystal structure of the chicken actin trimer complexed with human gelsolin segment 1 (GS-1)

SCOP Domain Sequences for d1mdud_:

Sequence; same for both SEQRES and ATOM records:

>d1mdud_ d.109.1.1 (D:) Gelsolin {Human (Homo sapiens)}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

Timeline for d1mdud_:

• d1mdud_ is new in SCOP 1.63
  
• d1mdud_ appears in SCOP 1.65
  
• d1mdud_ appears in the current release, SCOPe 2.08