Lineage for d1mdmb_ (1mdm B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210555Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 210755Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 210760Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 210764Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)
  8. 210773Domain d1mdmb_: 1mdm B: [79012]
    Other proteins in same PDB: d1mdma1, d1mdma2

Details for d1mdmb_

PDB Entry: 1mdm (more details), 2.8 Å

PDB Description: inhibited fragment of ets-1 and paired domain of pax5 bound to dna

SCOP Domain Sequences for d1mdmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdmb_ a.4.5.21 (B:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
rdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdp
devarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpee
lhamldvkp

SCOP Domain Coordinates for d1mdmb_:

Click to download the PDB-style file with coordinates for d1mdmb_.
(The format of our PDB-style files is described here.)

Timeline for d1mdmb_: