SCOP 1.71: Domain d1mdma2: 1mdm A:82-142

Lineage for d1mdma2 (1mdm A:82-142)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.5: Paired domain [46748] (3 proteins)
   duplication: consists of two domains of this fold

6. Protein Pax-5 [68962] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [68963] (2 PDB entries)

8. Domain d1mdma2: 1mdm A:82-142 [79011]
   Other proteins in same PDB: d1mdmb_

Details for d1mdma2

PDB Entry: 1mdm, 2.8 Å

PDB Description: inhibited fragment of ets-1 and paired domain of pax5 bound to dna

SCOP Domain Sequences for d1mdma2:

Sequence; same for both SEQRES and ATOM records:

>d1mdma2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens)}
viggskpkvatpkvvekiaeykrqnptmfaweirdrllaervcdndtvpsvssinriirt
k

Timeline for d1mdma2:

• d1mdma2 first appeared in SCOP 1.63
  
• d1mdma2 appears in SCOP 1.69
  
• d1mdma2 appears in SCOP 1.73
  
• d1mdma2 appears in the current release, SCOPe 2.08