Lineage for d1mdma1 (1mdm A:19-81)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438309Family a.4.1.5: Paired domain [46748] (3 proteins)
    duplication: consists of two domains of this fold
  6. 438313Protein Pax-5 [68962] (1 species)
  7. 438314Species Human (Homo sapiens) [TaxId:9606] [68963] (2 PDB entries)
  8. 438320Domain d1mdma1: 1mdm A:19-81 [79010]
    Other proteins in same PDB: d1mdmb_

Details for d1mdma1

PDB Entry: 1mdm (more details), 2.8 Å

PDB Description: inhibited fragment of ets-1 and paired domain of pax5 bound to dna

SCOP Domain Sequences for d1mdma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdma1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens)}
gvnqlggvfvngrplpdvvrqrivelahqgvrpcdisrqlrvshgcvskilgryyetgsi
kpg

SCOP Domain Coordinates for d1mdma1:

Click to download the PDB-style file with coordinates for d1mdma1.
(The format of our PDB-style files is described here.)

Timeline for d1mdma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mdma2
View in 3D
Domains from other chains:
(mouse over for more information)
d1mdmb_