Lineage for d1mczf3 (1mcz F:342-525)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242757Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 242758Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
    both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
    conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules
  5. 242759Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 242770Protein Benzoylformate decarboxylase [52526] (1 species)
  7. 242771Species Pseudomonas putida [TaxId:303] [52527] (2 PDB entries)
  8. 242785Domain d1mczf3: 1mcz F:342-525 [78969]
    Other proteins in same PDB: d1mcza1, d1mczb1, d1mczc1, d1mczd1, d1mcze1, d1mczf1, d1mczg1, d1mczh1, d1mczi1, d1mczj1, d1mczk1, d1mczl1, d1mczm1, d1mczn1, d1mczo1, d1mczp1

Details for d1mczf3

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate

SCOP Domain Sequences for d1mczf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczf3 c.36.1.1 (F:342-525) Benzoylformate decarboxylase {Pseudomonas putida}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

SCOP Domain Coordinates for d1mczf3:

Click to download the PDB-style file with coordinates for d1mczf3.
(The format of our PDB-style files is described here.)

Timeline for d1mczf3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3