SCOPe 2.04: Domain d1mc8b2: 1mc8 B:2-220

Lineage for d1mc8b2 (1mc8 B:2-220)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [82436] (1 PDB entry)

8. Domain d1mc8b2: 1mc8 B:2-220 [78948]
   Other proteins in same PDB: d1mc8a1, d1mc8b1
   mutant

Details for d1mc8b2

PDB Entry: 1mc8, 3.1 Å

PDB Description: crystal structure of flap endonuclease-1 r42e mutant from pyrococcus horikoshii

PDB Compounds: (B:) Flap Endonuclease-1

SCOPe Domain Sequences for d1mc8b2:

Sequence; same for both SEQRES and ATOM records:

>d1mc8b2 c.120.1.2 (B:2-220) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus horikoshii [TaxId: 53953]}
gvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsgl
fyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearkya
qratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfga
prlirnltitgkrkmpgkdvyveikpelvvldevlkelk

Timeline for d1mc8b2:

• d1mc8b2 first appeared in SCOP 1.63
  
• d1mc8b2 appears in SCOPe 2.03
  
• d1mc8b2 appears in SCOPe 2.05
  
• d1mc8b2 appears in the current release, SCOPe 2.08