Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (3 families) |
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species) |
Species Pyrococcus horikoshii [TaxId:53953] [82436] (1 PDB entry) |
Domain d1mc8a2: 1mc8 A:2-220 [78946] Other proteins in same PDB: d1mc8a1, d1mc8b1 mutant |
PDB Entry: 1mc8 (more details), 3.1 Å
SCOPe Domain Sequences for d1mc8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mc8a2 c.120.1.2 (A:2-220) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus horikoshii [TaxId: 53953]} gvpigdlvprkeidlenlygkkiaidalnaiyqflstirqedgtplmdskgritshlsgl fyrtinlmeagikpayvfdgkppefkrkelekrreareeaelkwkealakgnleearkya qratkvnemliedakkllqlmgipiiqapsegeaqaaymaskgdvyasasqdydsllfga prlirnltitgkrkmpgkdvyveikpelvvldevlkelk
Timeline for d1mc8a2: