Lineage for d1mbxd_ (1mbx D:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859729Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 859730Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 859754Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)
  6. 859755Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 859756Species Escherichia coli [TaxId:562] [82643] (7 PDB entries)
  8. 859762Domain d1mbxd_: 1mbx D: [78930]
    Other proteins in same PDB: d1mbxa_, d1mbxb_
    complex with ClpA N-domain
    complexed with cl, gol, ybt, zn

Details for d1mbxd_

PDB Entry: 1mbx (more details), 2.25 Å

PDB Description: crystal structure analysis of clpsn with transition metal ion bound
PDB Compounds: (D:) Protein yljA

SCOP Domain Sequences for d1mbxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbxd_ d.45.1.2 (D:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
aetkvamvnkyarenehpllctleka

SCOP Domain Coordinates for d1mbxd_:

Click to download the PDB-style file with coordinates for d1mbxd_.
(The format of our PDB-style files is described here.)

Timeline for d1mbxd_: