SCOP 1.69: Domain d1mbxc_: 1mbx C:

Lineage for d1mbxc_ (1mbx C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (2 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)

6. Protein Adaptor protein ClpS (YljA) [82642] (1 species)

7. Species Escherichia coli [TaxId:562] [82643] (5 PDB entries)

8. Domain d1mbxc_: 1mbx C: [78929]
   Other proteins in same PDB: d1mbxa_, d1mbxb_

Details for d1mbxc_

PDB Entry: 1mbx, 2.25 Å

PDB Description: crystal structure analysis of clpsn with transition metal ion bound

SCOP Domain Sequences for d1mbxc_:

Sequence; same for both SEQRES and ATOM records:

>d1mbxc_ d.45.1.2 (C:) Adaptor protein ClpS (YljA) {Escherichia coli}
dalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftae
vaetkvamvnkyarenehpllctleka

Timeline for d1mbxc_:

• d1mbxc_ first appeared in SCOP 1.63
  
• d1mbxc_ appears in SCOP 1.67
  
• d1mbxc_ appears in SCOP 1.71
  
• d1mbxc_ appears in the current release, SCOPe 2.08