Lineage for d1mbxc_ (1mbx C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946590Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2946591Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2946615Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 2946616Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 2946617Species Escherichia coli [TaxId:562] [82643] (8 PDB entries)
  8. 2946631Domain d1mbxc_: 1mbx C: [78929]
    Other proteins in same PDB: d1mbxa_, d1mbxb_
    complex with ClpA N-domain
    complexed with cl, gol, ybt, zn

Details for d1mbxc_

PDB Entry: 1mbx (more details), 2.25 Å

PDB Description: crystal structure analysis of clpsn with transition metal ion bound
PDB Compounds: (C:) Protein yljA

SCOPe Domain Sequences for d1mbxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbxc_ d.45.1.2 (C:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
dalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftae
vaetkvamvnkyarenehpllctleka

SCOPe Domain Coordinates for d1mbxc_:

Click to download the PDB-style file with coordinates for d1mbxc_.
(The format of our PDB-style files is described here.)

Timeline for d1mbxc_: