Lineage for d1mbvb_ (1mbv B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025155Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 1025156Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 1025180Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 1025181Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 1025182Species Escherichia coli [TaxId:562] [82643] (8 PDB entries)
  8. 1025200Domain d1mbvb_: 1mbv B: [78926]
    Other proteins in same PDB: d1mbva_
    complex with ClpA N-domain

Details for d1mbvb_

PDB Entry: 1mbv (more details), 3.3 Å

PDB Description: crystal structure analysis of clpsn heterodimer tetragonal form
PDB Compounds: (B:) Protein yljA

SCOPe Domain Sequences for d1mbvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbvb_ d.45.1.2 (B:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
aetkvamvnkyarenehpllctleka

SCOPe Domain Coordinates for d1mbvb_:

Click to download the PDB-style file with coordinates for d1mbvb_.
(The format of our PDB-style files is described here.)

Timeline for d1mbvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mbva_