Lineage for d1mbvb_ (1mbv B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503224Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 503225Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 503240Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)
  6. 503241Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 503242Species Escherichia coli [TaxId:562] [82643] (5 PDB entries)
  8. 503249Domain d1mbvb_: 1mbv B: [78926]
    Other proteins in same PDB: d1mbva_
    complex with ClpA N-domain

Details for d1mbvb_

PDB Entry: 1mbv (more details), 3.3 Å

PDB Description: crystal structure analysis of clpsn heterodimer tetragonal form

SCOP Domain Sequences for d1mbvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbvb_ d.45.1.2 (B:) Adaptor protein ClpS (YljA) {Escherichia coli}
alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
aetkvamvnkyarenehpllctleka

SCOP Domain Coordinates for d1mbvb_:

Click to download the PDB-style file with coordinates for d1mbvb_.
(The format of our PDB-style files is described here.)

Timeline for d1mbvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mbva_