![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
![]() | Superfamily d.45.1: ClpS-like [54736] (2 families) ![]() |
![]() | Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein) |
![]() | Protein Adaptor protein ClpS (YljA) [82642] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82643] (5 PDB entries) |
![]() | Domain d1mbuc_: 1mbu C: [78923] Other proteins in same PDB: d1mbua_, d1mbub_ |
PDB Entry: 1mbu (more details), 2.3 Å
SCOP Domain Sequences for d1mbuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbuc_ d.45.1.2 (C:) Adaptor protein ClpS (YljA) {Escherichia coli} alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev aetkvamvnkyarenehpllctleka
Timeline for d1mbuc_: