Lineage for d1mbuc_ (1mbu C:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256590Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 256591Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 256601Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)
  6. 256602Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 256603Species Escherichia coli [TaxId:562] [82643] (5 PDB entries)
  8. 256606Domain d1mbuc_: 1mbu C: [78923]
    Other proteins in same PDB: d1mbua_, d1mbub_

Details for d1mbuc_

PDB Entry: 1mbu (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of ClpSN heterodimer

SCOP Domain Sequences for d1mbuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbuc_ d.45.1.2 (C:) Adaptor protein ClpS (YljA) {Escherichia coli}
alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
aetkvamvnkyarenehpllctleka

SCOP Domain Coordinates for d1mbuc_:

Click to download the PDB-style file with coordinates for d1mbuc_.
(The format of our PDB-style files is described here.)

Timeline for d1mbuc_: