Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NSP4 proteinase [82128] (1 species) minimal fold; contains C-terminal extension |
Species Equine arteritis virus, EAV [TaxId:11047] [82129] (1 PDB entry) |
Domain d1mbmc_: 1mbm C: [78918] |
PDB Entry: 1mbm (more details), 2 Å
SCOP Domain Sequences for d1mbmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbmc_ b.47.1.3 (C:) NSP4 proteinase {Equine arteritis virus, EAV} kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv davprslamli
Timeline for d1mbmc_: