Lineage for d1mbmc_ (1mbm C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 377097Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 377125Protein NSP4 proteinase [82128] (1 species)
    minimal fold; contains C-terminal extension
  7. 377126Species Equine arteritis virus, EAV [TaxId:11047] [82129] (1 PDB entry)
  8. 377129Domain d1mbmc_: 1mbm C: [78918]

Details for d1mbmc_

PDB Entry: 1mbm (more details), 2 Å

PDB Description: nsp4 proteinase from equine arteritis virus

SCOP Domain Sequences for d1mbmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbmc_ b.47.1.3 (C:) NSP4 proteinase {Equine arteritis virus, EAV}
kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf
aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq
gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv
davprslamli

SCOP Domain Coordinates for d1mbmc_:

Click to download the PDB-style file with coordinates for d1mbmc_.
(The format of our PDB-style files is described here.)

Timeline for d1mbmc_: