![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein NSP4 proteinase [82128] (1 species) minimal fold; contains C-terminal extension |
![]() | Species Equine arteritis virus, EAV [TaxId:11047] [82129] (1 PDB entry) |
![]() | Domain d1mbmb_: 1mbm B: [78917] |
PDB Entry: 1mbm (more details), 2 Å
SCOPe Domain Sequences for d1mbmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbmb_ b.47.1.3 (B:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} kargnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdf aeavttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvq gdavvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadv davprslamlid
Timeline for d1mbmb_: