Lineage for d1mb4a1 (1mb4 A:1-132,A:355-369)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828665Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1828741Species Vibrio cholerae [TaxId:666] [82297] (4 PDB entries)
  8. 1828744Domain d1mb4a1: 1mb4 A:1-132,A:355-369 [78908]
    Other proteins in same PDB: d1mb4a2, d1mb4b2
    complexed with cys, ndp

Details for d1mb4a1

PDB Entry: 1mb4 (more details), 1.84 Å

PDB Description: crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with nadp and s-methyl-l-cysteine sulfoxide
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1mb4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]}
mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
gihhgtktfvggXaaeplrrtlriilae

SCOPe Domain Coordinates for d1mb4a1:

Click to download the PDB-style file with coordinates for d1mb4a1.
(The format of our PDB-style files is described here.)

Timeline for d1mb4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mb4a2