SCOPe 2.06: Domain d1m9nb2: 1m9n B:201-593

Lineage for d1m9nb2 (1m9n B:201-593)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
   duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs

6. Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [64200] (9 PDB entries)
   Uniprot P31335

8. Domain d1m9nb2: 1m9n B:201-593 [78873]
   Other proteins in same PDB: d1m9na1, d1m9nb1
   complexed with amz, k, xmp

Details for d1m9nb2

PDB Entry: 1m9n, 1.93 Å

PDB Description: crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.

PDB Compounds: (B:) aicar transformylase-imp cyclohydrolase

SCOPe Domain Sequences for d1m9nb2:

Sequence; same for both SEQRES and ATOM records:

>d1m9nb2 c.97.1.4 (B:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

Timeline for d1m9nb2:

• d1m9nb2 first appeared in SCOP 1.63
  
• d1m9nb2 appears in SCOPe 2.05
  
• d1m9nb2 appears in SCOPe 2.07
  
• d1m9nb2 appears in the current release, SCOPe 2.08