![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein) duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs |
![]() | Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [64200] (8 PDB entries) Uniprot P31335 |
![]() | Domain d1m9nb2: 1m9n B:201-593 [78873] Other proteins in same PDB: d1m9na1, d1m9nb1 complexed with amz, k, xmp |
PDB Entry: 1m9n (more details), 1.93 Å
SCOPe Domain Sequences for d1m9nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9nb2 c.97.1.4 (B:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi vapsgsaadevvieacnelgitlihtnlrlfhh
Timeline for d1m9nb2: