Lineage for d1m94a_ (1m94 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 253999Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 254000Family d.15.1.1: Ubiquitin-related [54237] (7 proteins)
  6. 254046Protein Ubiquitin-like modifier protein hub1 [82579] (1 species)
  7. 254047Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82580] (1 PDB entry)
  8. 254048Domain d1m94a_: 1m94 A: [78865]
    structural genomics protein

Details for d1m94a_

PDB Entry: 1m94 (more details)

PDB Description: Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1

SCOP Domain Sequences for d1m94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae)}
mievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpnkivlqkggsvlkdhisledy
evhdqtnlelyyl

SCOP Domain Coordinates for d1m94a_:

Click to download the PDB-style file with coordinates for d1m94a_.
(The format of our PDB-style files is described here.)

Timeline for d1m94a_: