Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) automatically mapped to Pfam PF01198 |
Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
Protein Ribosomal protein L31e [54577] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) Uniprot P18138 |
Domain d1m90y_: 1m90 Y: [78863] Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90z_ complexed with aca, cd, cl, k, mg, na, pha, sps |
PDB Entry: 1m90 (more details), 2.8 Å
SCOPe Domain Sequences for d1m90y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m90y_ d.29.1.1 (Y:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]} ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant pskirvraarfeeegeaiveae
Timeline for d1m90y_:
View in 3D Domains from other chains: (mouse over for more information) d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90z_ |