Lineage for d1m90l_ (1m90 L:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373873Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 373874Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 373875Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 373876Protein Ribosomal protein L14 [50195] (2 species)
  7. 373877Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (18 PDB entries)
  8. 373879Domain d1m90l_: 1m90 L: [78850]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90l_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m90l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90l_ b.39.1.1 (L:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1m90l_:

Click to download the PDB-style file with coordinates for d1m90l_.
(The format of our PDB-style files is described here.)

Timeline for d1m90l_: