Lineage for d1m90j_ (1m90 J:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602120Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 602121Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 602122Protein Ribosomal protein L10e [54688] (1 species)
  7. 602123Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (19 PDB entries)
  8. 602125Domain d1m90j_: 1m90 J: [78848]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90j_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m90j_:

Sequence, based on SEQRES records: (download)

>d1m90j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1m90j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOP Domain Coordinates for d1m90j_:

Click to download the PDB-style file with coordinates for d1m90j_.
(The format of our PDB-style files is described here.)

Timeline for d1m90j_: