Lineage for d1m90h_ (1m90 H:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258900Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 258984Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 258985Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 258997Protein Ribosomal protein L7ae [55319] (1 species)
  7. 258998Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (8 PDB entries)
  8. 259000Domain d1m90h_: 1m90 H: [78846]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90h_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m90h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90h_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1m90h_:

Click to download the PDB-style file with coordinates for d1m90h_.
(The format of our PDB-style files is described here.)

Timeline for d1m90h_: