SCOP 1.65: Domain d1m904_: 1m90 4:

Lineage for d1m904_ (1m90 4:)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (12 PDB entries)

8. Domain d1m904_: 1m90 4: [78838]
   Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
   complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m904_

PDB Entry: 1m90, 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m904_:

Sequence; same for both SEQRES and ATOM records:

>d1m904_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1m904_:

• d1m904_ first appeared in SCOP 1.63
  
• d1m904_ appears in SCOP 1.67
  
• d1m904_ appears in the current release, SCOPe 2.08