![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
![]() | Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) ![]() |
![]() | Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein) incomplete barrel of 6 strands, the last PK strand is missing |
![]() | Protein ATP sulfurylase N-terminal domain [63802] (3 species) |
![]() | Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63804] (2 PDB entries) |
![]() | Domain d1m8pb1: 1m8p B:1-170 [78780] Other proteins in same PDB: d1m8pa2, d1m8pa3, d1m8pb2, d1m8pb3, d1m8pc2, d1m8pc3 |
PDB Entry: 1m8p (more details), 2.6 Å
SCOP Domain Sequences for d1m8pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8pb1 b.58.1.2 (B:1-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum)} manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmn qadydrvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtid diyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhyd
Timeline for d1m8pb1: