Lineage for d1m8pa3 (1m8p A:391-573)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 244034Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)
  6. 244035Protein ATP sulfurylase C-terminal domain [64012] (2 species)
  7. 244047Species Fungus (Penicillium chrysogenum) [TaxId:5076] [64014] (2 PDB entries)
  8. 244048Domain d1m8pa3: 1m8p A:391-573 [78779]
    Other proteins in same PDB: d1m8pa1, d1m8pa2, d1m8pb1, d1m8pb2, d1m8pc1, d1m8pc2

Details for d1m8pa3

PDB Entry: 1m8p (more details), 2.6 Å

PDB Description: Crystal Structure of P. chrysogenum ATP Sulfurylase in the T-state

SCOP Domain Sequences for d1m8pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum)}
pratqgftifltgymnsgkdaiaralqvtlnqqggrsvslllgdtvrhelsselgftred
rhtniqriafvateltragaaviaapiapyeesrkfardavsqagsfflvhvatplehce
qsdkrgiyaaarrgeikgftgvddpyetpekadlvvdfskqsvrsivheiilvlesqgfl
erq

SCOP Domain Coordinates for d1m8pa3:

Click to download the PDB-style file with coordinates for d1m8pa3.
(The format of our PDB-style files is described here.)

Timeline for d1m8pa3: