Lineage for d1m7ja3 (1m7j A:62-419)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236978Superfamily c.1.9: Metallo-dependent hydrolases [51556] (12 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 237118Family c.1.9.11: D-aminoacylase, catalitic domain [82264] (1 protein)
  6. 237119Protein N-acyl-D-aminoacid amidohydrolase, catalytic domain [82265] (1 species)
    contains small a/b subdomain inserted after strand 7; unusual for the superfamily metal coordination by Cys
  7. 237120Species Alcaligenes faecalis [TaxId:511] [82266] (1 PDB entry)
  8. 237121Domain d1m7ja3: 1m7j A:62-419 [78734]
    Other proteins in same PDB: d1m7ja1, d1m7ja2
    complexed with act, zn

Details for d1m7ja3

PDB Entry: 1m7j (more details), 1.5 Å

PDB Description: crystal structure of d-aminoacylase defines a novel subset of amidohydrolases
PDB Compounds: (A:)

SCOP Domain Sequences for d1m7ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis}
gfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldeggsf
rfarfsdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdalas
gaigistgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrigre
ldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvllag
rtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafgpt
migsdglphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaerg

SCOP Domain Coordinates for d1m7ja3:

Click to download the PDB-style file with coordinates for d1m7ja3.
(The format of our PDB-style files is described here.)

Timeline for d1m7ja3: