SCOPe 2.05: Domain d1m63c_: 1m63 C:

Lineage for d1m63c_ (1m63 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (78 PDB entries)
   Uniprot P05092

8. Domain d1m63c_: 1m63 C: [78679]
   Other proteins in same PDB: d1m63a_, d1m63b_, d1m63e_, d1m63f_
   complexed with calcineurin and cyclosporin (chain D and H)
   complexed with ca, fe, zn

Details for d1m63c_

PDB Entry: 1m63, 2.8 Å

PDB Description: crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes

PDB Compounds: (C:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1m63c_:

Sequence; same for both SEQRES and ATOM records:

>d1m63c_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1m63c_:

• d1m63c_ first appeared in SCOP 1.63
  
• d1m63c_ appears in SCOPe 2.04
  
• d1m63c_ appears in SCOPe 2.06
  
• d1m63c_ appears in the current release, SCOPe 2.08