| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein Porin chaperone SurA, PPIase domains [82624] (1 species) |
| Species Escherichia coli [TaxId:562] [82625] (4 PDB entries) |
| Domain d1m5yc3: 1m5y C:283-385 [78672] Other proteins in same PDB: d1m5ya1, d1m5yb1, d1m5yc1, d1m5yd1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1m5y (more details), 3 Å
SCOPe Domain Sequences for d1m5yc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5yc3 d.26.1.1 (C:283-385) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]}
tevharhillkpspimtdeqarvkleqiaadiksgkttfaaaakefsqdpgsanqggdlg
watpdifdpafrdaltrlnkgqmsapvhssfgwhlielldtrn
Timeline for d1m5yc3: