Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.2: UEV domain [75383] (3 proteins) |
Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries) |
Domain d1m4qa_: 1m4q A: [78608] complex with a hiv-1 ptap "late domain" peptide |
PDB Entry: 1m4q (more details)
SCOPe Domain Sequences for d1m4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq sdllgliqvmivvfgdeppvfsrp
Timeline for d1m4qa_: