Class b: All beta proteins [48724] (119 folds) |
Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll |
Superfamily b.13.2: Viral proteins [49749] (3 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits, form ring structures of six rather than five domains |
Family b.13.2.3: Major capsid protein vp54 [82013] (1 protein) |
Protein Major capsid protein vp54 [82014] (1 species) |
Species Paramecium bursaria chorella virus type 1, PBCV-1 [82015] (2 PDB entries) a large, lipid-containing, DNA virus |
Domain d1m3yb1: 1m3y B:25-221 [78581] |
PDB Entry: 1m3y (more details), 2 Å
SCOP Domain Sequences for d1m3yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3yb1 b.13.2.3 (B:25-221) Major capsid protein vp54 {Paramecium bursaria chorella virus type 1, PBCV-1} tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv wvdyifldtqertrfaq
Timeline for d1m3yb1: