Lineage for d1m3yb1 (1m3y B:25-221)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225773Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 225793Superfamily b.13.2: Viral proteins [49749] (3 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits, form ring structures of six rather than five domains
  5. 225823Family b.13.2.3: Major capsid protein vp54 [82013] (1 protein)
  6. 225824Protein Major capsid protein vp54 [82014] (1 species)
  7. 225825Species Paramecium bursaria chorella virus type 1, PBCV-1 [82015] (2 PDB entries)
    a large, lipid-containing, DNA virus
  8. 225828Domain d1m3yb1: 1m3y B:25-221 [78581]

Details for d1m3yb1

PDB Entry: 1m3y (more details), 2 Å

PDB Description: the structure of major capsid protein of a large, lipid containing, dna virus

SCOP Domain Sequences for d1m3yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3yb1 b.13.2.3 (B:25-221) Major capsid protein vp54 {Paramecium bursaria chorella virus type 1, PBCV-1}
tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
wvdyifldtqertrfaq

SCOP Domain Coordinates for d1m3yb1:

Click to download the PDB-style file with coordinates for d1m3yb1.
(The format of our PDB-style files is described here.)

Timeline for d1m3yb1: