Lineage for d1m3ya1 (1m3y A:25-221)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304390Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 304410Superfamily b.121.2: Group II dsDNA viruses VP [49749] (3 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 304440Family b.121.2.3: Major capsid protein vp54 [82013] (1 protein)
  6. 304441Protein Major capsid protein vp54 [82014] (1 species)
  7. 304442Species Paramecium bursaria chorella virus type 1, PBCV-1 [82015] (2 PDB entries)
    a large, lipid-containing, DNA virus
  8. 304443Domain d1m3ya1: 1m3y A:25-221 [78579]

Details for d1m3ya1

PDB Entry: 1m3y (more details), 2 Å

PDB Description: the structure of major capsid protein of a large, lipid containing, dna virus

SCOP Domain Sequences for d1m3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3ya1 b.121.2.3 (A:25-221) Major capsid protein vp54 {Paramecium bursaria chorella virus type 1, PBCV-1}
tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
wvdyifldtqertrfaq

SCOP Domain Coordinates for d1m3ya1:

Click to download the PDB-style file with coordinates for d1m3ya1.
(The format of our PDB-style files is described here.)

Timeline for d1m3ya1: