Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.124: NagB/RpiA/CoA transferase [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase [100950] (4 families) |
Family c.124.1.3: CoA transferase beta subunit-like [74657] (2 proteins) catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest |
Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [82467] (5 PDB entries) |
Domain d1m3eb2: 1m3e B:259-481 [78560] Other proteins in same PDB: d1m3ea1, d1m3eb1, d1m3ec1, d1m3ed1 |
PDB Entry: 1m3e (more details), 2.5 Å
SCOP Domain Sequences for d1m3eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3eb2 c.124.1.3 (B:259-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)} gdnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqn evdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipg klvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfd vdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt
Timeline for d1m3eb2: