Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein 2-aminoethylphosphonate transaminase [82486] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [82487] (1 PDB entry) |
Domain d1m32b_: 1m32 B: [78509] complexed with plp, po4, poa |
PDB Entry: 1m32 (more details), 2.2 Å
SCOPe Domain Sequences for d1m32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m32b_ c.67.1.3 (B:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} nyllltpgplttsrtvkeamlfdsctwdddynigvveqirqqltalatasegytsvllqg sgsyaveavlgsalgpqdkvlivsngaygarmvemaglmgiahhaydcgevarpdvqaid ailnadptishiamvhsetttgmlnpidevgalahrygktyivdamssfggipmdiaalh idylissankciqgvpgfafviareqklaackghsrslsldlyaqwrcmednhgkwrfts pthtvlafaqalkelakeggvaarhqryqqnqrslvagmralgfntllddelhspiitaf yspedpqyrfsefyrrlkeqgfviypgkvsqsdcfrignigevyaaditalltairtamy wt
Timeline for d1m32b_: