Lineage for d1m2wa1 (1m2w A:193-492)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284127Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 284128Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 284220Family a.100.1.9: Mannitol 2-dehydrogenase [81843] (1 protein)
  6. 284221Protein Mannitol 2-dehydrogenase [81844] (1 species)
    duplication; contains two structural repeats
  7. 284222Species Pseudomonas fluorescens [TaxId:294] [81845] (2 PDB entries)
  8. 284224Domain d1m2wa1: 1m2w A:193-492 [78502]
    Other proteins in same PDB: d1m2wa2, d1m2wb2

Details for d1m2wa1

PDB Entry: 1m2w (more details), 1.8 Å

PDB Description: Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and D-mannitol

SCOP Domain Sequences for d1m2wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2wa1 a.100.1.9 (A:193-492) Mannitol 2-dehydrogenase {Pseudomonas fluorescens}
phngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstahrlqlhdehgidd
awpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkigllngshlaltylgfl
kgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvdrfsnqaiadqle
rvcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvdengvsytipdprae
fcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdngvtttlkhllkkp

SCOP Domain Coordinates for d1m2wa1:

Click to download the PDB-style file with coordinates for d1m2wa1.
(The format of our PDB-style files is described here.)

Timeline for d1m2wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m2wa2