Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) |
Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins) |
Protein Sec23 [82921] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (3 PDB entries) |
Domain d1m2oc5: 1m2o C:45-119 [78490] Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa4, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc4, d1m2od_ complexed with gnp, mg, zn |
PDB Entry: 1m2o (more details), 2.5 Å
SCOPe Domain Sequences for d1m2oc5:
Sequence, based on SEQRES records: (download)
>d1m2oc5 g.41.10.1 (C:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple lqsttieyitnkpvt
>d1m2oc5 g.41.10.1 (C:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnenmplelqs ttieyitnkpvt
Timeline for d1m2oc5: